Mouse Anti-PLLP Antibody (CBMOAB-54824FYA)


Cat: CBMOAB-54824FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54824FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO54824FYA 100 µg
MO-AB-18094R Monoclonal Cattle (Bos taurus) WB, ELISA MO18094R 100 µg
MO-AB-27932H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27932C 100 µg
MO-AB-35450W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35450W 100 µg
MO-AB-61767W Monoclonal Marmoset WB, ELISA MO61767W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus)
CloneMO54824FYA
SpecificityThis antibody binds to Rhesus PLLP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PLLP Antibody is a mouse antibody against PLLP. It can be used for PLLP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlasmolipin; PLLP
UniProt IDH9FB69
Protein RefseqThe length of the protein is 31 amino acids long.
The sequence is show below: IAYGVSAFFSYQAWRGVGSNAATSQMAGGYA.
For Research Use Only | Not For Clinical Use.
Online Inquiry