AibGenesis™ Mouse Anti-Pnn Antibody (CBMOAB-27930FYA)


Cat: CBMOAB-27930FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27930FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO27930FYA 100 µg
Inquiry
CBMOAB-93128FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93128FYA 100 µg
Inquiry
MO-AB-06368H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06368C 100 µg
Inquiry
MO-AB-14236W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14236W 100 µg
Inquiry
MO-AB-18158R Monoclonal Cattle (Bos taurus) WB, ELISA MO18158R 100 µg
Inquiry
MO-AB-32778W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32778W 100 µg
Inquiry
MO-AB-35455W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35455W 100 µg
Inquiry
MO-AB-61854W Monoclonal Marmoset WB, ELISA MO61854W 100 µg
Inquiry
MO-DKB-02842W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO27930FYA
SpecificityThis antibody binds to fruit fly Pnn.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5''CAGGTG-3''. Capable of reversing CTBP1-mediated transcription repression. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5''-splice sites. Component of the PSAP complex which binds RNA in a sequence-independent manner and is proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. Involved in the establishment and maintenance of epithelia cell-cell adhesion. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Pnn Antibody is a mouse antibody against Pnn. It can be used for Pnn detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPinin, isoform B; Pnn
UniProt IDA8JQW3
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MVNDSGLSTVDDLEQKLNSAKQSLVILNENIRRIAGRVPKESLQRSEKFKYTQDGKKNEHNGDRPFPRNATPGGVFKDKRRMYESKNPISRFPIEENEGRPPRINSRVIREMPTKKEIVEAQGTDSESRARNRRMFGSLLGTLQKFCQEESRLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLEYKMARMKDFKVWEATMLNAKNNIRTKTKPHLFFRPKVHSPRTEKLLSKSKSEADVFIEFRREELEVELKNLENMNFGKMEDDTAIDESFYEEPDDEEQLDKSLLYVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry