Mouse Anti-PNPLA3 Antibody (CBMOAB-54928FYA)


Cat: CBMOAB-54928FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54928FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54928FYA 100 µg
CBMOAB-93147FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93147FYA 100 µg
MO-AB-03488Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03488Y 100 µg
MO-AB-06371H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06371C 100 µg
MO-AB-61859W Monoclonal Marmoset WB, ELISA MO61859W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO54928FYA
SpecificityThis antibody binds to Rhesus PNPLA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PNPLA3 Antibody is a mouse antibody against PNPLA3. It can be used for PNPLA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPNPLA3
UniProt IDF6VKY9
Protein RefseqThe length of the protein is 481 amino acids long.
The sequence is show below: MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNIGKFLRQDLYKYLPANVHQLISGKICVSLTRVSDGENVLVSDFQSKDEVVDALICSCFIPFYSGLIPPSFRGVRYVDGGASDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNKPQRGLKSSSEGMDSEVTAPGWENTSLDSSPEPAALAMRLDGDELLDHLRLSILPWDESILDTLSPELATAVSEAMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVQWLQWVTSQVFTRALMCLLPASRSQMPVSGEQASPCKPEQDWHCWTPCSPEDCPAEAKAEATPRSILRSSLNFFWGNKVPAGAEGLSTFPSFSLEKNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry