AibGenesis™ Mouse Anti-pnrc2 Antibody (CBMOAB-93166FYA)


Cat: CBMOAB-93166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93166FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO93166FYA 100 µg
MO-AB-03491Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03491Y 100 µg
MO-AB-18171R Monoclonal Cattle (Bos taurus) WB, ELISA MO18171R 100 µg
MO-AB-27955H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27955C 100 µg
MO-AB-46094W Monoclonal Horse (Equus caballus) WB, ELISA MO46094W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO93166FYA
SpecificityThis antibody binds to Zebrafish pnrc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for upf1/rent1 localization to the P-body. Also acts as a nuclear receptor coactivator. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish pnrc2 Antibody is a mouse antibody against pnrc2. It can be used for pnrc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProline-rich nuclear receptor coactivator 2; pnrc
UniProt IDB7TWP7
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: MGGGERYNIPDRPAPKKSQPVSRGKQRSRDQNGVMHSAASGALGVPHHLRRGEKGTSYSWSPEARQAVSVDKKNGSVRFATPYDQNWESHLNKLLSAQCGQNYAGAKFSEPPSPSVLPKPPSHWVSLPMGDHRELMTFQLKSLLKVQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry