AibGenesis™ Mouse Anti-Ppan Antibody (CBMOAB-28082FYA)


Cat: CBMOAB-28082FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28082FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO28082FYA 100 µg
CBMOAB-39220FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO39220FC 100 µg
CBMOAB-55064FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55064FYA 100 µg
CBMOAB-93417FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93417FYA 100 µg
MO-AB-06443H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06443C 100 µg
MO-AB-18179W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18179W 100 µg
MO-AB-62005W Monoclonal Marmoset WB, ELISA MO62005W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO28082FYA
SpecificityThis antibody binds to fruit fly Ppan.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for initiation of larval growth and normal mitotic growth but is not absolutely required for general biosynthesis or DNA replication. Required for progression of normal oogenesis and maturation of some imaginal tissues into adult structures. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Ppan Antibody is a mouse antibody against Ppan. It can be used for Ppan detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Peter pan; ppan
UniProt IDQ9VDE5
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: MGGKKKVHPKTRTAAFKASEPSEIVEAPHSFVIHRGLACPYITDLTLDFRRIMEPFTASNLREKRMNRIKDFVSLSSFFHVSHMGIFNKASTQLSFKVVRLPRGPSLTFKVHQFTLARDVISLSKKQMIDNDHFKHAPLVIMNNFSGDGKHLKLMATTFQNMFPSINLATVNIGTIRRCVLFSYNPDTKLVEMRHYSVQVVPVGLKRAVQKIVKGTVPNLGKCNEVVDFVTKDGYASESEAEDDEQSHVVLAQTLKSKGNLEDKKSSIKLHEIGPRLTMQLIKIEEGLLTGEVLYHDHVVKTEDEKETLRKLVEKKRKQKEQRKKEQAENRARNLKLKKDEKWAAKRAAEGRTDSDPEDDAEYYKEEVGEEPDEELFKMEAKSSRKRPSLGGGMKYKNKRAKLDTKDKNDKSERTDKYDRKDKFDRKDKKDKFDPKNRRAKFDPKNKRAKFDHRKSRKSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry