AibGenesis™ Mouse Anti-PPM1M Antibody (CBMOAB-55132FYA)


Cat: CBMOAB-55132FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55132FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO55132FYA 100 µg
MO-AB-05309W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05309W 100 µg
MO-AB-23174W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23174W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO55132FYA
SpecificityThis antibody binds to Rhesus PPM1M.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PPM1M Antibody is a mouse antibody against PPM1M. It can be used for PPM1M detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPM1M
UniProt IDF7HSB3
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MHLNGRCICPSDPQFVEEKGIRAEDLVIGALESAFQECDEVIGRELEASGQVGGCTALVAVSLQGKLYVANAGDSRAILVRRDEIRPLSFEFTPETERQRIQQLAFVYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVGQLELQEDDVVVMATDGLWDVLSNEQVAWLVRSFLPGNQEDPHRYCSCWGPAWAWVGASSKPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry