AibGenesis™ Mouse Anti-PPP1R3D Antibody (CBMOAB-55190FYA)


Cat: CBMOAB-55190FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55190FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO55190FYA 100 µg
MO-AB-01168L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01168L 100 µg
MO-AB-17206Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17206Y 100 µg
MO-AB-18372R Monoclonal Cattle (Bos taurus) WB, ELISA MO18372R 100 µg
MO-AB-24446W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24446W 100 µg
MO-AB-28519R Monoclonal Pig (Sus scrofa) WB, ELISA MO28519R 100 µg
MO-AB-32859W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32859W 100 µg
MO-AB-62125W Monoclonal Marmoset WB, ELISA MO62125W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO55190FYA
SpecificityThis antibody binds to Rhesus PPP1R3D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PPP1R3D Antibody is a mouse antibody against PPP1R3D. It can be used for PPP1R3D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein phosphatase 1 regulatory subunit 3; PPP1R3D
UniProt IDF6QS91
Protein RefseqThe length of the protein is 299 amino acids long.
The sequence is show below: MSRGPSSAVLPSALGSRKLTPRSLSCLSDLDGGVALEPRPCRPPGSPGRAPPPAPAPSGCDPRLRPIILRRARSLPSSPERRQKAAGAPGAACRPGCSRQLRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLQYLVPDFPPPVEAADFGERLQRQLVCLERVTCSDLGISGTVRVCNVAFEKQVAVRYTFSGWRSTHEAVARWRGPEGPEGKEDVFTFGFPVPPFLLELGSRVHFAVRYRVAGAEYWDNNDCRDYSLTCRNHALHMPRGECEESWIHFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry