Mouse Anti-PPP1R42 Antibody (CBMOAB-55196FYA)


Cat: CBMOAB-55196FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55196FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO55196FYA 100 µg
CBMOAB-93654FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93654FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO55196FYA
SpecificityThis antibody binds to Rhesus PPP1R42.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PPP1R42 Antibody is a mouse antibody against PPP1R42. It can be used for PPP1R42 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPP1R42
UniProt IDF7EJP3
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLSILNISNNNIDDIRDLEILENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGTYLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry