Mouse Anti-PPP2R3A Antibody (CBMOAB-55212FYA)


Cat: CBMOAB-55212FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55212FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55212FYA 100 µg
CBMOAB-93687FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93687FYA 100 µg
MO-AB-06496H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06496C 100 µg
MO-AB-11183W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11183W 100 µg
MO-AB-18386R Monoclonal Cattle (Bos taurus) WB, ELISA MO18386R 100 µg
MO-AB-62154W Monoclonal Marmoset WB, ELISA MO62154W 100 µg
MO-DKB-01075W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO55212FYA
SpecificityThis antibody binds to Rhesus PPP2R3A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the regulatory subunits of the protein phosphatase 2. Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. (From NCBI)
Product OverviewMouse Anti-Rhesus PPP2R3A Antibody is a mouse antibody against PPP2R3A. It can be used for PPP2R3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPP2R3A
UniProt IDF6R6S3
Protein RefseqThe length of the protein is 529 amino acids long.
The sequence is show below: MMIKETSLRRDPDLRGELAFLARGCDFVLPSRFKKRLKSFQQTQIQNKPEKKPGTPLPPPATSPSSPQPLSPVPHVNNVVNAPLSINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEDQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTSQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKGSKILSASLPEKCGKLQSVDEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry