AibGenesis™ Mouse Anti-pqlc2 Antibody (CBMOAB-93765FYA)


Cat: CBMOAB-93765FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93765FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO93765FYA 100 µg
MO-AB-06515H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06515C 100 µg
MO-AB-18413R Monoclonal Cattle (Bos taurus) WB, ELISA MO18413R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO93765FYA
SpecificityThis antibody binds to Zebrafish pqlc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pqlc2 Antibody is a mouse antibody against pqlc2. It can be used for pqlc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namespqlc2; NP_001013321.2
UniProt IDB0S5U0
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MSDGFELGGGGNFSSLCPNGIAWIWYGLGECAQDGRDVASVVLGLLSIVCFMVSSIPQYYSSCKTGNMDSALSIWFLLFWLAGDSCNLIGSFLADQLPLQKYTAVYYVVADLLMLAMYMYYKLKNKRSSDRALLNALSVLCLLGMTSSLLSIPHWSLEDQMPSGFRGRALLALEEDNGAVQPFKTREIIGFVIGSISSVLYLCSRLPQIYTNFQRKSTEGLSYFLFALVILGNTTYGVSVLLKNPDPGQGEASYMVHHLPWLIGSLGTLSLDLVISVQFMMYRKSPQVSADTDEERAALLQN.
For Research Use Only | Not For Clinical Use.
Online Inquiry