Mouse Anti-PRAF2 Antibody (CBMOAB-55264FYA)


Cat: CBMOAB-55264FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55264FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55264FYA 100 µg
CBMOAB-93771FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93771FYA 100 µg
MO-AB-18416R Monoclonal Cattle (Bos taurus) WB, ELISA MO18416R 100 µg
MO-AB-23603W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23603W 100 µg
MO-AB-62209W Monoclonal Marmoset WB, ELISA MO62209W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO55264FYA
SpecificityThis antibody binds to Rhesus PRAF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRAF2 Antibody is a mouse antibody against PRAF2. It can be used for PRAF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRA1 family protein 2; PRAF2
UniProt IDH9F606
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: FVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGMLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVVGGACTFLLSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry