Mouse Anti-PRAP1 Antibody (CBMOAB-55273FYA)


Cat: CBMOAB-55273FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55273FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO55273FYA 100 µg
MO-AB-28024H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28024C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO55273FYA
SpecificityThis antibody binds to Rhesus PRAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRAP1 Antibody is a mouse antibody against PRAP1. It can be used for PRAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRAP1
UniProt IDF7HIM7
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: PLRVLMVTSLVAVLLWEAGAASAPKLPIKVHVKHRPSEQEAEKAWGARVVEPPEKDDQLVGLLPVPKPKLLTAEKSPGQGRGPVLPGIKASVETEDILGHVLSPQQGPEPDHDSLHHPPPEEDQGEEGPRLWVMPNRQVLRGPEEDQDHMYHPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry