AibGenesis™ Mouse Anti-PRIMA1 Antibody (CBMOAB-55313FYA)


Cat: CBMOAB-55313FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55313FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Rat (Rattus norvegicus) WB, ELISA MO55313FYA 100 µg
MO-AB-03556Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03556Y 100 µg
MO-AB-18459R Monoclonal Cattle (Bos taurus) WB, ELISA MO18459R 100 µg
MO-AB-28038H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28038C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Rat (Rattus norvegicus)
CloneMO55313FYA
SpecificityThis antibody binds to Rhesus PRIMA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRIMA1 Antibody is a mouse antibody against PRIMA1. It can be used for PRIMA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProline-rich membrane anchor 1; PRIMA1
UniProt IDH9F3X8
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: PPPPRLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSTSQSNKGVDVNNTVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry