AibGenesis™ Mouse Anti-PRR15 Antibody (MO-AB-11500W)


Cat: MO-AB-11500W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11500W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO11500W 100 µg
MO-AB-17405Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17405Y 100 µg
MO-AB-28102H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28102C 100 µg
MO-AB-62375W Monoclonal Marmoset WB, ELISA MO62375W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO11500W
SpecificityThis antibody binds to Chimpanzee PRR15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee PRR15 Antibody is a mouse antibody against PRR15. It can be used for PRR15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProline rich 15; PRR15
UniProt IDH2QUC4
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MADSGGAGSSGPWWKSLTNSRKKSKEASVGVQPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGEPPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry