AibGenesis™ Mouse Anti-PRR30 Antibody (CBMOAB-55451FYA)


Cat: CBMOAB-55451FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55451FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55451FYA 100 µg
MO-AB-05373W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05373W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO55451FYA
SpecificityThis antibody binds to Rhesus PRR30.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRR30 Antibody is a mouse antibody against PRR30. It can be used for PRR30 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRR30
UniProt IDF6PQ50
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MLPQNKDQVLPQTSVLPGCPPWGFSQLVDSSPHNLQPLSAHQSLRPSHPPFFSTQSHHPSFSPPASPSPGFQFGSCDPNSDFVPHPCSPSLPSSPTFFHQNYLSLPNPRASSPSNHWLYPSPPLTPSFSPSQPQNSSLPHSPCQSPSHPEDLHSSTLTSPGPSPPSQRLHSNRQTWRWHQYRDTGSGSPGVVERCVPSEKDPAQFRDPGALAQALVVQLGHRRIAHDLRLLLLQHLWLGRTGQAPVVEYPICLVCLRPRSPSCPLPKYRTGPRLLAFPQLLPCVEGQESGPLRIGIGFGLRLPQGQARALHLLPEKRPKEVGPQGKDPQACGHPSPAFRPPAAQARADPAPGTPSQTRSFRSAGLQSPNSPRCFSGPPPRAPKQATTSPKPRPCPAPKRPVSLELILQKSSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry