AibGenesis™ Mouse Anti-PRR7 Antibody (CBMOAB-55458FYA)


Cat: CBMOAB-55458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55458FYA Monoclonal Rhesus (Macaca mulatta), Arabidopsis (Arabidopsis lyrata), Chimpanzee (Pan troglodytes), Marmoset, Sugar beet (Beta vulgaris) WB, ELISA MO55458FYA 100 µg
MO-AB-00837H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00837C 100 µg
MO-AB-26193W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26193W 100 µg
MO-AB-30481H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30481C 100 µg
MO-AB-62384W Monoclonal Marmoset WB, ELISA MO62384W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Arabidopsis (Arabidopsis lyrata), Chimpanzee (Pan troglodytes), Marmoset, Sugar beet (Beta vulgaris)
CloneMO55458FYA
SpecificityThis antibody binds to Rhesus PRR7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRR7 Antibody is a mouse antibody against PRR7. It can be used for PRR7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRR7
UniProt IDF6WFJ2
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHPHAHPHPHPHPHHHALPHPPPPHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYNSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry