Mouse Anti-Prx Antibody (MO-AB-70260W)


Cat: MO-AB-70260W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-70260W Monoclonal Silkworm (Bombyx mori), Grape (Vitis vinifera), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO70260W 100 µg
CBMOAB-55530FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55530FYA 100 µg
CBMOAB-94195FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94195FYA 100 µg
MO-AB-39427W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39427W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori), Grape (Vitis vinifera), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO70260W
SpecificityThis antibody binds to Silkworm Prx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Silkworm Prx Antibody is a mouse antibody against Prx. It can be used for Prx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1-Cys peroxiredoxin; Prx; LOC692792
UniProt IDA8D0B7
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MLLLGKTFPDFSANTTEGEINFHEWLGDKWGILFSHPSDFTPVCTTELARVLVLLPEFVKRNTKVIGLSCDSVSSHLEWCKDIKSFAGCNEDEPFPYPIIEDEKRELANKLGMIDNDELDHKGMPLTARAVFIVDPNKKFRLSILYPATTGRNFDEILRILDSLQLTDKAKVATPVDWKAGDDCMVLPTVPEDQIKTCFPQGVNVVPLPSGKNYLRKTACPKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry