AibGenesis™ Mouse Anti-PSAC Antibody (CBMOAB-39384FYC)
Cat: CBMOAB-39384FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39384FYC | Monoclonal | WB, ELISA | MO39384FC | 100 µg | |||
| CBMOAB-88916FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88916FYB | 100 µg | ||
| MO-AB-00504W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00504W | 100 µg | ||
| MO-AB-01904L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01904L | 100 µg | ||
| MO-AB-30483H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30483C | 100 µg | ||
| MO-AB-39428W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39428W | 100 µg | ||
| MO-DKB-01631W | Polyclonal | A. thaliana (Arabidopsis thaliana), Rice (Oryza sativa) | WB | 100 µg | |||
| MO-DKB-01995W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MO-DKB-0407RA | Polyclonal | WB | 50 µL |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza sativa), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii); Cyanophora paradoxa; Dactylis glomeRat (Rattus norvegicus)a; Emiliania huxleyi; Euglena gracilis; Gonyaulax polyedra; Horderum vulgare; Spinach (Spinacia oleracea); Heterosigma akashiwo;Micromonas pusilla; Phaeodactylum tricornutum; T. pseudonana (Thalassiosira pseudonana); T. punctigera (Thalassiosira punctigera); Trichodesmium erythraeum; T. aestivum (Triticum aestivum), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39384FC |
| Specificity | This antibody binds to Arabidopsis PSAC. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSAC Antibody is a mouse antibody against PSAC. It can be used for PSAC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem I iron-sulfur center; EC 1.97.1.12; 9 kDa polypeptide; PSI-C; Photosystem I subunit VII; PsaC; psaC; frxA; AtCg01060 |
| UniProt ID | P62090 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry