AibGenesis™ Mouse Anti-PSME3IP1 Antibody (MO-AB-14862W)


Cat: MO-AB-14862W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14862W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus) WB, ELISA MO14862W 100 µg
MO-AB-18751R Monoclonal Cattle (Bos taurus) WB, ELISA MO18751R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus)
CloneMO14862W
SpecificityThis antibody binds to Chimpanzee PSME3IP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee PSME3IP1 Antibody is a mouse antibody against PSME3IP1. It can be used for PSME3IP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 192, member A; FAM192A
UniProt IDH2RA62
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MDGGDDGNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTPLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry