Mouse Anti-ptp Antibody (MO-AB-09409W)


Cat: MO-AB-09409W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09409W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO09409W 100 µg
MO-AB-09584Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09584Y 100 µg
MO-AB-18817R Monoclonal Cattle (Bos taurus) WB, ELISA MO18817R 100 µg
MO-AB-28190H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28190C 100 µg
MO-AB-32970W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32970W 100 µg
MO-AB-42432W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42432W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO09409W
SpecificityThis antibody binds to Cat ptp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat ptp Antibody is a mouse antibody against ptp. It can be used for ptp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein tyrosine phosphatase; ptp
UniProt IDQ9BEE6
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: NQNNAAGDVSVPGSLKTNGKLCEGRAEDTDCDGSPLPEDFTESIKMNGCEEYYEEKVKSESLIQKPQERKTDGDNEVAWASDELPMETTNLEDSNKDHPFLTNEELAAVPIVKVPPSGKYTGTKLKSVIRMLRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry