Mouse Anti-PTRH2 Antibody (CBMOAB-55745FYA)


Cat: CBMOAB-55745FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55745FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO55745FYA 100 µg
CBMOAB-94731FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94731FYA 100 µg
MO-AB-18843R Monoclonal Cattle (Bos taurus) WB, ELISA MO18843R 100 µg
MO-AB-21898W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21898W 100 µg
MO-AB-28206H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28206C 100 µg
MO-AB-62660W Monoclonal Marmoset WB, ELISA MO62660W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO55745FYA
SpecificityThis antibody binds to Rhesus PTRH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PTRH2 Antibody is a mouse antibody against PTRH2. It can be used for PTRH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeptidyl-tRNA hydrolase 2, mitochondrial; PTRH2
UniProt IDH9F7N6
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: SLRVRFGMLPESKTSKTHTDTESEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry