Mouse Anti-PTTG1IP Antibody (CBMOAB-55747FYA)


Cat: CBMOAB-55747FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55747FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO55747FYA 100 µg
MO-AB-12982W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12982W 100 µg
MO-AB-18847R Monoclonal Cattle (Bos taurus) WB, ELISA MO18847R 100 µg
MO-AB-28210H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28210C 100 µg
MO-AB-62666W Monoclonal Marmoset WB, ELISA MO62666W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO55747FYA
SpecificityThis antibody binds to Rhesus PTTG1IP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PTTG1IP Antibody is a mouse antibody against PTTG1IP. It can be used for PTTG1IP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPTTG1IP
UniProt IDF6QYT7
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: MAPGVARGPTPYWRLPLGGAALLLLLIPVAAAQEPRKMMCFQRTEKTSEVQLTNHNCIADWGSRQSACVCVDISSCLPFKSVCEPSSGGWVVCKMNFEALIITMSVVGGALLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN.
For Research Use Only | Not For Clinical Use.
Online Inquiry