AibGenesis™ Mouse Anti-Ptth Antibody (CBMOAB-28451FYA)


Cat: CBMOAB-28451FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28451FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO28451FYA 100 µg
MO-AB-70268W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70268W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO28451FYA
SpecificityThis antibody binds to fruit fly Ptth.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Ptth Antibody is a mouse antibody against Ptth. It can be used for Ptth detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProthoracicotropic hormone, isoform F; Ptth
UniProt IDX2JCX9
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MDIKVWRLLGQSCRRSTALVRHRSSMMPWLPISIMAMALLSLTNKGIASQYASDEGLDEMVGLRSLEHRAEEQQPDRSTSKMLSALFGFSPSTPHPTEMAMVMPHQLPPMYYNDFYEDLVTTKRNDVHSAGCDCKVTNELVDLGGLHFPRFLMNAVCESGAGRDLAKCSHGSNCRPLEYKVKVLAQTSQSDHPYSWMNKDQPWQFKTVTVTAGCFCTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry