Mouse Anti-Purple sea urchin HDC Antibody (MO-AB-30799H)
Cat: MO-AB-30799H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Purple sea urchin (Strongylocentrotus purpuratus) |
Clone | MO30799C |
Specificity | This antibody binds to Purple sea urchin HDC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the group II decarboxylase family and forms a homodimer that converts L-histidine to histamine in a pyridoxal phosphate dependent manner. Histamine regulates several physiologic processes, including neurotransmission, gastric acid secretion,inflamation, and smooth muscle tone. |
Product Overview | This product is a mouse antibody against HDC. It can be used for HDC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Histidine decarboxylase; HDC |
UniProt ID | Q58FK5 |
Protein Refseq | The length of the protein is 43 amino acids long. The sequence is show below: ADYLSTIRSRRTLPDVQPGYLKQLIPDHAPVNGDKWDDIMEDI. |
See other products for " HDC "
MO-AB-02272Y | Mouse Anti-Chicken HDC Antibody (MO-AB-02272Y) |
MO-NAB-00792W | Mouse Anti-Drosophila hdc Antibody (AA 44-462) |
MO-AB-13602R | Mouse Anti-Cattle HDC Antibody (MO-AB-13602R) |
CBMOAB-79212FYA | Mouse Anti-Zebrafish hdc Antibody (CBMOAB-79212FYA) |
CBMOAB-18454FYA | Mouse Anti-D. melanogaster Hdc Antibody (CBMOAB-18454FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry