Mouse Anti-rab3c Antibody (CBMOAB-95018FYA)


Cat: CBMOAB-95018FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95018FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO95018FYA 100 µg
MO-AB-18940R Monoclonal Cattle (Bos taurus) WB, ELISA MO18940R 100 µg
MO-AB-28286H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28286C 100 µg
MO-AB-62804W Monoclonal Marmoset WB, ELISA MO62804W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO95018FYA
SpecificityThis antibody binds to Zebrafish rab3c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish rab3c Antibody is a mouse antibody against rab3c. It can be used for rab3c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrab3c; RAB3C, Member RAS Oncogene Family
UniProt IDA8WHV3
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MELYGKMAATQDNKQKENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGGTPSARLTETPAPPQPSDCSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry