Mouse Anti-Rabbit ATG3 Antibody (MO-AB-07277Y)
Cat: MO-AB-07277Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07277Y |
Specificity | This antibody binds to Rabbit ATG3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. |
Product Overview | This product is a mouse antibody against ATG3. It can be used for ATG3 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Autophagy-related protein 3; LOC100348916 |
UniProt ID | G1T9W9 |
Protein Refseq | The length of the protein is 314 amino acids long. The sequence is show below: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDSIKLQDCSALCEEEEEEDEGEAADMEEYEESGLLETDEATLDTRKLVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM. |
See other products for " ATG3 "
MO-AB-00206Y | Mouse Anti-Chicken ATG3 Antibody (MO-AB-00206Y) |
CBMOAB-00748HCB | Mouse Anti-C. elegans ATG3 Antibody (CBMOAB-00748HCB) |
MO-AB-00120L | Mouse Anti-Elephant ATG3 Antibody (MO-AB-00120L) |
CBMOAB-02004FYA | Mouse Anti-D. melanogaster Atg3 Antibody (CBMOAB-02004FYA) |
MO-AB-29071W | Mouse Anti-Dog ATG3 Antibody (MO-AB-29071W) |
MO-AB-41275W | Mouse Anti-Guinea pig ATG3 Antibody (MO-AB-41275W) |
MO-AB-14279Y | Mouse Anti-Sheep Atg3 Antibody (MO-AB-14279Y) |
MO-AB-47416W | Mouse Anti-Maize ATG3 Antibody (MO-AB-47416W) |
CBMOAB-24516FYC | Mouse Anti-Arabidopsis ATG3 Antibody (CBMOAB-24516FYC) |
MO-AB-00099R | Mouse Anti-Medaka atg3 Antibody (MO-AB-00099R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry