Mouse Anti-Rabbit CLU Antibody (MO-AB-07645Y)
Cat: MO-AB-07645Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07645Y |
Specificity | This antibody binds to Rabbit CLU. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytoskeleton; Nucleus; Extracellular region or secreted; Cytosol; Endoplasmic reticulum; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Functions as extracellular chaperone that prevents aggregation of non native proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. When secreted, protects cells against apoptosis and against cytolysis by complement. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity (By similarity). Following stress, promotes apoptosis (By similarity). Inhibits apoptosis when associated with the mitochondrial membrane by interference with BAX-dependent release of cytochrome c into the cytoplasm. Plays a role in the regulation of cell proliferation. An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5. Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (By similarity). Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3 (By similarity). Plays a role in the clearance of immune complexes that arise during cell injury (By similarity). |
Product Overview | This product is a mouse antibody against CLU. It can be used for CLU detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Clusterin; CLU |
UniProt ID | G1SQ27 |
Protein Refseq | The length of the protein is 518 amino acids long. The sequence is show below: MQVCSQPRRGCTRAEHYKYGASRGSPRGVARRSARAPAPQTGETSPYFLALHRATPRQTDEQPGVAARGILGPQYPRRRRQDEDSAAVCGAAAELVSDNELQEMSTQGSKYIDREIQNAVKGVQEIKTLIEKTNEERKTLLSVLEEAKKNKEDALNETRDSETKLKAFPEVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWINGDRIDSLLENDRQQSHVLDVMQDSFNRATGIMDELFQDRFFTHKPQDTFYHSPFSYFRRPPLHYAKSRLVRNIMPLSLYGPLNFQDMFQPFFEMIHQAQQAMDVHLHSPAYQTPNVEFITGGPDDRAVCKEIRHNSTGCLRMKDQCAKCQEILSVDCSANNPSQNQLRQELNDSLRLAEELTKRYNELLQSYQWKMLNTSSLLDQLNEQFNWVSQLANLTQGPDQYYLRVSTVTSHTSESEAPSRVTEVVVKLFDSDPITITIPEEVSRDNPKFMETVAEKALQEYRKKKRVE. |
See other products for " Clu "
CBMOAB-13633FYA | Mouse Anti-D. melanogaster Clu Antibody (CBMOAB-13633FYA) |
MOFY-0722-FY195 | FITC conjugated antibody to CLU Antibody (MOFY-0722-FY195) |
MO-AB-32932H | Mouse Anti-Nile tilapia clu Antibody (MO-AB-32932H) |
MO-AB-01247Y | Mouse Anti-Chicken CLU Antibody (MO-AB-01247Y) |
CBMOAB-70832FYA | Mouse Anti-Zebrafish clu Antibody (CBMOAB-70832FYA) |
MO-AB-10372R | Mouse Anti-Cattle CLU Antibody (MO-AB-10372R) |
MOFY-0622-FY30 | Mouse Anti-CLU Antibody (MOFY-0622-FY30) |
MO-AB-22371W | Mouse Anti-Chimpanzee CLU Antibody (MO-AB-22371W) |
MO-AB-02489H | Mouse Anti-Frog clu Antibody (MO-AB-02489H) |
MO-AB-34597W | Mouse Anti-Ferret CLU Antibody (MO-AB-34597W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry