Mouse Anti-Rabbit DBI Antibody (MO-AB-07869Y)
Cat: MO-AB-07869Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus) |
| Clone | MO07869Y |
| Specificity | This antibody binds to Rabbit DBI. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor (By similarity). |
| Product Overview | This product is a mouse antibody against DBI. It can be used for DBI detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl-CoA-binding protein; ACBP; Diazepam-binding inhibitor; DBI; Endozepine; EP; DBI |
| UniProt ID | Q8WN94 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MSQAEFEKAAEEVKNLKTKPADAEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWNELKGTSKESAMRAYVDKVEELKQKYGI. |
See other products for " DBI "
| MO-AB-23123H | Mouse Anti-Mallard DBI Antibody (MO-AB-23123H) |
| MO-AB-24358W | Mouse Anti-Chimpanzee DBI Antibody (MO-AB-24358W) |
| MO-AB-11192R | Mouse Anti-Cattle DBI Antibody (MO-AB-11192R) |
| MO-AB-02869H | Mouse Anti-Frog dbi Antibody (MO-AB-02869H) |
| CBMOAB-72963FYA | Mouse Anti-Zebrafish dbi Antibody (CBMOAB-72963FYA) |
| MO-AB-01552Y | Mouse Anti-Chicken DBI Antibody (MO-AB-01552Y) |
| CBMOAB-14624FYA | Mouse Anti-D. melanogaster Dbi Antibody (CBMOAB-14624FYA) |
| MO-AB-26488W | Mouse Anti-Chimpanzee DBI Antibody (MO-AB-26488W) |
| MO-AB-30108W | Mouse Anti-Dog DBI Antibody (MO-AB-30108W) |
| MO-AB-01840W | Mouse Anti-Rhesus DBI Antibody (MO-AB-01840W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry