Mouse Anti-Rabbit DBI Antibody (MO-AB-07869Y)
Cat: MO-AB-07869Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07869Y |
Specificity | This antibody binds to Rabbit DBI. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endoplasmic reticulum; Golgi apparatus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor (By similarity). |
Product Overview | This product is a mouse antibody against DBI. It can be used for DBI detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl-CoA-binding protein; ACBP; Diazepam-binding inhibitor; DBI; Endozepine; EP; DBI |
UniProt ID | Q8WN94 |
Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MSQAEFEKAAEEVKNLKTKPADAEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWNELKGTSKESAMRAYVDKVEELKQKYGI. |
See other products for " dbi "
MO-AB-02869H | Mouse Anti-Frog dbi Antibody (MO-AB-02869H) |
MO-AB-01552Y | Mouse Anti-Chicken DBI Antibody (MO-AB-01552Y) |
MO-AB-24358W | Mouse Anti-Chimpanzee DBI Antibody (MO-AB-24358W) |
CBMOAB-14624FYA | Mouse Anti-D. melanogaster Dbi Antibody (CBMOAB-14624FYA) |
MO-AB-53927W | Mouse Anti-Marmoset DBI Antibody (MO-AB-53927W) |
MO-AB-25282H | Mouse Anti-Rat Dbi Antibody (MO-AB-25282H) |
MO-AB-30108W | Mouse Anti-Dog DBI Antibody (MO-AB-30108W) |
MO-AB-01840W | Mouse Anti-Rhesus DBI Antibody (MO-AB-01840W) |
MO-AB-11192R | Mouse Anti-Cattle DBI Antibody (MO-AB-11192R) |
MO-AB-23123H | Mouse Anti-Mallard DBI Antibody (MO-AB-23123H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry