Mouse Anti-rabggtb Antibody (CBMOAB-95098FYA)


Cat: CBMOAB-95098FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95098FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Frog (Xenopus), Marmoset WB, ELISA MO95098FYA 100 µg
MO-AB-06845H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06845C 100 µg
MO-AB-18469W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18469W 100 µg
MO-AB-18972R Monoclonal Cattle (Bos taurus) WB, ELISA MO18972R 100 µg
MO-AB-28733R Monoclonal Pig (Sus scrofa) WB, ELISA MO28733R 100 µg
MO-AB-62852W Monoclonal Marmoset WB, ELISA MO62852W 100 µg
MO-DKB-00886W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Frog (Xenopus), Marmoset
CloneMO95098FYA
SpecificityThis antibody binds to Zebrafish rabggtb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residues of Rab GTPases. Three small nucleolar RNA genes are present in the intronic regions of this gene. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 3. (From NCBI)
Product OverviewMouse Anti-Zebrafish rabggtb Antibody is a mouse antibody against rabggtb. It can be used for rabggtb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRab geranylgeranyltransferase, beta subunit; Rabggtb protein; rabggt
UniProt IDQ4V946
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MGTQVKDVTIKPDAPNTLFLDKHADYIAAYGSKKDDYEYTLSEYLRMSGIYWGLTVMDLMGQLSRMNREEIIEFIKSCQHDCGGISASIGHDPHLLYTLSAIQILSLYDSVNAIDVDKVVEYVKGLQQEDGSFAGDKWGEIDTRFSFCAVATLALLGKLDVINVDKAVEFVMSCMNFDGGFGCRPGSESHAGQIYCCTGFLSVTGQLHQVNADLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRIHWIDKAKLRNFILACQDEETGGFADRPGDMVDPFHTLFGVAGLSLLGDEQIKPVNPVFCMPEDVLQRIGLQPDLLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry