Mouse Anti-Rae1 Antibody (CBMOAB-28734FYA)
Cat: CBMOAB-28734FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-28734FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO28734FYA | 100 µg | ||
CBMOAB-39768FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO39768FC | 100 µg | ||
CBMOAB-95170FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95170FYA | 100 µg | ||
MO-AB-06878H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06878C | 100 µg | ||
MO-AB-19003R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19003R | 100 µg | ||
MO-AB-24080W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24080W | 100 µg | ||
MO-AB-42458W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42458W | 100 µg | ||
MO-AB-62886W | Monoclonal | Marmoset | WB, ELISA | MO62886W | 100 µg | ||
MO-DKB-03387W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio) | WB, IF | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset |
Clone | MO28734FYA |
Specificity | This antibody binds to fruit fly Rae1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Product Overview | Mouse Anti-D. melanogaster Rae1 Antibody is a mouse antibody against Rae1. It can be used for Rae1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | LD40776p; Fragment; Rae1 |
UniProt ID | Q7JVX4 |
Protein Refseq | The length of the protein is 360 amino acids long. The sequence is show below: IIQTQTFCGNKSRRMFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKCHRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry