Mouse Anti-Rae1 Antibody (CBMOAB-28734FYA)


Cat: CBMOAB-28734FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28734FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset WB, ELISA MO28734FYA 100 µg
CBMOAB-39768FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO39768FC 100 µg
CBMOAB-95170FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95170FYA 100 µg
MO-AB-06878H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06878C 100 µg
MO-AB-19003R Monoclonal Cattle (Bos taurus) WB, ELISA MO19003R 100 µg
MO-AB-24080W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24080W 100 µg
MO-AB-42458W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42458W 100 µg
MO-AB-62886W Monoclonal Marmoset WB, ELISA MO62886W 100 µg
MO-DKB-03387W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset
CloneMO28734FYA
SpecificityThis antibody binds to fruit fly Rae1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-D. melanogaster Rae1 Antibody is a mouse antibody against Rae1. It can be used for Rae1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD40776p; Fragment; Rae1
UniProt IDQ7JVX4
Protein RefseqThe length of the protein is 360 amino acids long.
The sequence is show below: IIQTQTFCGNKSRRMFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKCHRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry