Mouse Anti-RAG2 Antibody (CBMOAB-89018FYB)
Cat: CBMOAB-89018FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-89018FYB | Monoclonal | Rice (Oryza), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO89018FYB | 100 µg | ||
| CBMOAB-55986FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO55986FYA | 100 µg | ||
| MO-AB-09378W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09378W | 100 µg | ||
| MO-AB-43395W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43395W | 100 µg | ||
| MO-AB-46300W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46300W | 100 µg | ||
| MO-AB-19007R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19007R | 100 µg | ||
| MO-AB-28739R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28739R | 100 µg | ||
| MO-AB-06887H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06887C | 100 µg | ||
| MO-AB-28317H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28317C | 100 µg | ||
| MO-AB-01247L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01247L | 100 µg | ||
| MO-AB-03678Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03678Y | 100 µg | ||
| MO-AB-09642Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09642Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rice (Oryza), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO89018FYB |
| Specificity | This antibody binds to Rice RAG2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. |
| Product Overview | Mouse Anti-Rice RAG2 Antibody is a mouse antibody against RAG2. It can be used for RAG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Seed allergenic protein RAG2; Seed allergenic protein RA14; allergen Ory s aA_TI; RAG2; RA14; Os07g0214300 LOC_Os07g11380 |
| UniProt ID | Q01882 |
| Protein Refseq | The length of the protein is 166 amino acids long. The sequence is show below: MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH. |
See other products for " rag2 "
| CBMOAB-95189FYA | Mouse Anti-rag2 Antibody (CBMOAB-95189FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry