Mouse Anti-Rala Antibody (CBMOAB-28739FYA)


Cat: CBMOAB-28739FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28739FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO28739FYA 100 µg
MO-AB-06908H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06908C 100 µg
MO-AB-10811W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10811W 100 µg
MO-AB-19012R Monoclonal Cattle (Bos taurus) WB, ELISA MO19012R 100 µg
MO-AB-28319H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28319C 100 µg
MO-AB-62897W Monoclonal Marmoset WB, ELISA MO62897W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO28739FYA
SpecificityThis antibody binds to fruit fly Rala.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.
Product OverviewMouse Anti-D. melanogaster Rala Antibody is a mouse antibody against Rala. It can be used for Rala detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas-related protein Ral-a; Rala
UniProt IDP48555
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MSKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLKCTLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry