Mouse Anti-Ran Antibody (CBMOAB-28742FYA)


Cat: CBMOAB-28742FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28742FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa) WB, ELISA MO28742FYA 100 µg
CBMOAB-56026FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56026FYA 100 µg
CBMOAB-95222FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95222FYA 100 µg
MO-AB-10966W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10966W 100 µg
MO-AB-12945Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12945Y 100 µg
MO-AB-17469Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17469Y 100 µg
MO-AB-19027R Monoclonal Cattle (Bos taurus) WB, ELISA MO19027R 100 µg
MO-AB-28335H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28335C 100 µg
MO-AB-28747R Monoclonal Pig (Sus scrofa) WB, ELISA MO28747R 100 µg
MO-AB-33042W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33042W 100 µg
MO-AB-62921W Monoclonal Marmoset WB, ELISA MO62921W 100 µg
MO-DKB-00501W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa)
CloneMO28742FYA
SpecificityThis antibody binds to fruit fly Ran.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis and cell cycle progression. Nuclear localization of RAN requires the presence of regulator of chromosome condensation 1 (RCC1). Mutations in RAN disrupt DNA synthesis. Because of its many functions, it is likely that RAN interacts with several other proteins. RAN regulates formation and organization of the microtubule network independently of its role in the nucleus-cytosol exchange of macromolecules. RAN could be a key signaling molecule regulating microtubule polymerization during mitosis. RCC1 generates a high local concentration of RAN-GTP around chromatin which, in turn, induces the local nucleation of microtubules. RAN is an androgen receptor (AR) coactivator that binds differentially with different lengths of polyglutamine within the androgen receptor. Polyglutamine repeat expansion in the AR is linked to Kennedy's disease (X-linked spinal and bulbar muscular atrophy). RAN coactivation of the AR diminishes with polyglutamine expansion within the AR, and this weak coactivation may lead to partial androgen insensitivity during the development of Kennedy's disease.
Product OverviewMouse Anti-D. melanogaster Ran Antibody is a mouse antibody against Ran. It can be used for Ran detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTP-binding nuclear protein Ran; Ras-related nuclear protein; ran; Ran10A
UniProt IDQ9VZ23
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQIERDLQEAQATALPDEDEEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry