Mouse Anti-Ran Antibody (CBMOAB-28742FYA)
Cat: CBMOAB-28742FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-28742FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa) | WB, ELISA | MO28742FYA | 100 µg | ||
CBMOAB-56026FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56026FYA | 100 µg | ||
CBMOAB-95222FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95222FYA | 100 µg | ||
MO-AB-10966W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10966W | 100 µg | ||
MO-AB-12945Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12945Y | 100 µg | ||
MO-AB-17469Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17469Y | 100 µg | ||
MO-AB-19027R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19027R | 100 µg | ||
MO-AB-28335H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28335C | 100 µg | ||
MO-AB-28747R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28747R | 100 µg | ||
MO-AB-33042W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33042W | 100 µg | ||
MO-AB-62921W | Monoclonal | Marmoset | WB, ELISA | MO62921W | 100 µg | ||
MO-DKB-00501W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, IF | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa) |
Clone | MO28742FYA |
Specificity | This antibody binds to fruit fly Ran. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Cytoskeleton; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis and cell cycle progression. Nuclear localization of RAN requires the presence of regulator of chromosome condensation 1 (RCC1). Mutations in RAN disrupt DNA synthesis. Because of its many functions, it is likely that RAN interacts with several other proteins. RAN regulates formation and organization of the microtubule network independently of its role in the nucleus-cytosol exchange of macromolecules. RAN could be a key signaling molecule regulating microtubule polymerization during mitosis. RCC1 generates a high local concentration of RAN-GTP around chromatin which, in turn, induces the local nucleation of microtubules. RAN is an androgen receptor (AR) coactivator that binds differentially with different lengths of polyglutamine within the androgen receptor. Polyglutamine repeat expansion in the AR is linked to Kennedy's disease (X-linked spinal and bulbar muscular atrophy). RAN coactivation of the AR diminishes with polyglutamine expansion within the AR, and this weak coactivation may lead to partial androgen insensitivity during the development of Kennedy's disease. (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-D. melanogaster Ran Antibody is a mouse antibody against Ran. It can be used for Ran detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GTP-binding nuclear protein Ran; Ras-related nuclear protein; ran; Ran10A |
UniProt ID | Q9VZ23 |
Protein Refseq | The length of the protein is 216 amino acids long. The sequence is show below: MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQIERDLQEAQATALPDEDEEL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry