Mouse Anti-Rap Antibody (CBMOAB-28771FYA)


Cat: CBMOAB-28771FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28771FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Rice (Oryza) WB, ELISA MO28771FYA 100 µg
CBMOAB-39816FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO39816FC 100 µg
CBMOAB-89022FYB Monoclonal Rice (Oryza) WB, ELISA MO89022FYB 100 µg
MO-AB-03683Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03683Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Rice (Oryza)
CloneMO28771FYA
SpecificityThis antibody binds to fruit fly Rap.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRNA-binding protein required for chloroplast 16S rRNA maturation, an important process which supports chloroplast gene expression and biogenesis. Binds to 16S rRNA precursor and is involved in its 5''-end processing (PubMed:24585838). May act as negative regulator of defense response against bacterial pathogens (PubMed:18003861). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Rap Antibody is a mouse antibody against Rap. It can be used for Rap detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG3000-PA, isoform A; GH07620p; RE20929p; Retina aberrant in pattern, isoform B; rap
UniProt IDQ9W4H9
Protein RefseqThe length of the protein is 478 amino acids long.
The sequence is show below: MFSPEYEKRILKHYSPVARNLFNNFESSTTPTSLDRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDCGETARDSLAYSCLLKNELLGSAIDDVKTAGEERNENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFSKARSQKENKSVLNLFANIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry