AibGenesis™ Mouse Anti-RAR1 Antibody (CBMOAB-39833FYC)
Cat: CBMOAB-39833FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39833FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Rice (Oryza) | WB, ELISA | MO39833FC | 100 µg | ||
| CBMOAB-89025FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89025FYB | 100 µg | ||
| MO-DKB-02281W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza) |
| Clone | MO39833FC |
| Specificity | This antibody binds to Arabidopsis RAR1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Required specifically for plant innate immunity. Is essential for resistance conferred by multiple R genes recognizing different bacterial and oomycete pathogen isolates like avirulent P.syringae or H.parasitica (downy mildew). Contributes additively with SGT1B to RPP5-dependent resistance. Functions as positive regulator of RPS5 accumulation by assisting its stabilization. May function as co-chaperone of HSP90-2 to positively regulate the steady-state accumulation of RPM1 and protect it from SGT1-mediated degradation. Acts as negative regulator of pathogen-associated molecular pattern (PAMP)-triggered immunity. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis RAR1 Antibody is a mouse antibody against RAR1. It can be used for RAR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cysteine and histidine-rich domain-containing protein RAR1; AtRAR1; CHORD domain-containing protein RAR1; Protein PPHB SUSCEPTIBLE 2; Protein REQUIRED FOR MLA12 RESISTANCE 1; RAR1; PBS2 RPR2; At5g51700 |
| UniProt ID | Q9SE33 |
| Protein Refseq | The length of the protein is 226 amino acids long. The sequence is show below: MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV. |
Reference
| Reference | 1. Tornero, P., Merritt, P., Sadanandom, A., Shirasu, K., Innes, R. W., & Dangl, J. L. (2002). RAR1 and NDR1 contribute quantitatively to disease resistance in Arabidopsis, and their relative contributions are dependent on the R gene assayed. The Plant Cell, 14(5), 1005-1015. 2. Zhou, F., Mosher, S., Tian, M., Sassi, G., Parker, J., & Klessig, D. F. (2008). The Arabidopsis gain-of-function mutant ssi4 requires RAR1 and SGT1b differentially for defense activation and morphological alterations. Molecular plant-microbe interactions, 21(1), 40-49. 3. Takahashi, A., Casais, C., Ichimura, K., & Shirasu, K. (2003). HSP90 interacts with RAR1 and SGT1 and is essential for RPS2-mediated disease resistance in Arabidopsis. Proceedings of the National Academy of Sciences, 100(20), 11777-11782. |
For Research Use Only | Not For Clinical Use.
Online Inquiry