Mouse Anti-RARB Antibody (MO-AB-01254L)
Cat: MO-AB-01254L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01254L | Monoclonal | Elephant (Loxodonta africana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO01254L | 100 µg | ||
| MO-AB-05540W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05540W | 100 µg | ||
| MO-AB-06931H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06931C | 100 µg | ||
| MO-AB-17090W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17090W | 100 µg | ||
| MO-AB-23671H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23671C | 100 µg | ||
| MO-AB-28752R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28752R | 100 µg | ||
| MO-AB-62959W | Monoclonal | Marmoset | WB, ELISA | MO62959W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Elephant (Loxodonta africana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) |
| Clone | MO01254L |
| Specificity | This antibody binds to Elephant RARB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. Alternate promoter usage and differential splicing result in multiple transcript variants. |
| Product Overview | This product is a mouse antibody against RARB. It can be used for RARB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Retinoic Acid Receptor Beta; Nuclear Receptor Subfamily 1 Group B Member 2; HBV-Activated Protein; RAR-Epsilon; RAR-Beta; NR1B2; HAP |
| UniProt ID | O97781 |
| Protein Refseq | The length of the protein is 46 amino acids long. The sequence is show below: VRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry