AibGenesis™ Mouse Anti-rasd1 Antibody (CBMOAB-95312FYA)


Cat: CBMOAB-95312FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95312FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO95312FYA 100 µg
MO-AB-03689Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03689Y 100 µg
MO-AB-19063R Monoclonal Cattle (Bos taurus) WB, ELISA MO19063R 100 µg
MO-AB-19206W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19206W 100 µg
MO-AB-62972W Monoclonal Marmoset WB, ELISA MO62972W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO95312FYA
SpecificityThis antibody binds to Zebrafish rasd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish rasd1 Antibody is a mouse antibody against rasd1. It can be used for rasd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:65909; rasd1; zgc:6590
UniProt IDQ6PHV8
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MIKKMSPSENEFDIPAKNCYRMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDFHRKLYSIKGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKNKTKENVDVPLVICGNKGDREFYREVQRDEIEQLIAGDEQCAYFEISAKRNTNVDQMFQRLFTLAKLPNEMSPDLHRKVSVQYCDILHKKSLKNKKVKDGDAYGIVAPFARRPSVHSDLMYIKEKAIGGGQTKDKERCIIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry