Mouse Anti-Rat Acsl6 Antibody (MO-AB-23965H)
Cat: MO-AB-23965H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO23965C |
Specificity | This antibody binds to Rat Acsl6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene. |
Product Overview | This product is a mouse antibody against Acsl6. It can be used for Acsl6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl-CoA synthetase long-chain family member 6 variant AUG1; Acsl6 |
UniProt ID | B2BET9 |
Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MLTFFLVSGGSLWLFAEIALSLLEKMQTQEILRILRLPELSDLGQFFRSLSATTLVSMGALAAILAYWLTHRPKALQPPCNLLMQSE. |
See other products for " acsl6 "
CBMOAB-64735FYA | Mouse Anti-Zebrafish acsl6 Antibody (CBMOAB-64735FYA) |
MO-AB-50362W | Mouse Anti-Marmoset ACSL6 Antibody (MO-AB-50362W) |
MO-AB-06926R | Mouse Anti-Cattle ACSL6 Antibody (MO-AB-06926R) |
MO-AB-07066Y | Mouse Anti-Rabbit ACSL6 Antibody (MO-AB-07066Y) |
MO-AB-00922W | Mouse Anti-Rhesus ACSL6 Antibody (MO-AB-00922W) |
MO-AB-25290W | Mouse Anti-Chimpanzee ACSL6 Antibody (MO-AB-25290W) |
CBMOAB-35005FYA | Mouse Anti-Rhesus ACSL6 Antibody (CBMOAB-35005FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry