Mouse Anti-Rat AFP Antibody (MO-AB-23989H)
Cat: MO-AB-23989H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO23989C |
Specificity | This antibody binds to Rat AFP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. |
Product Overview | This product is a mouse antibody against AFP. It can be used for AFP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-fetoprotein; AFP |
UniProt ID | Q63033 |
Protein Refseq | The length of the protein is 29 amino acids long. The sequence is show below: ESVMTHICSQQEILSSKTAECCKLPTIEL. |
See other products for " AFP "
MOFY-0722-FY206 | Rabbit Anti-AFP Antibody (MOFY-0722-FY206) |
MO-AB-19632W | Mouse Anti-Chimpanzee AFP Antibody (MO-AB-19632W) |
MO-AB-23604R | Mouse Anti-Pig afp Antibody (MO-AB-23604R) |
MO-AB-43603W | Mouse Anti-Horse AFP Antibody (MO-AB-43603W) |
MOFY-0722-FY137 | Rabbit Anti-AFP Antibody (MOFY-0722-FY137) |
MO-AB-38431W | Mouse Anti-Gorilla AFP Antibody (MO-AB-38431W) |
MOFY-0722-FY53 | Mouse Anti-AFP Antibody (MOFY-0722-FY53) |
MO-AB-07099R | Mouse Anti-Cattle AFP Antibody (MO-AB-07099R) |
CBMOAB-35297FYA | Mouse Anti-Rhesus AFP Antibody (CBMOAB-35297FYA) |
MO-AB-28866W | Mouse Anti-Dog AFP Antibody (MO-AB-28866W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry