Mouse Anti-Rat ALS2 Antibody (MO-AB-24046H)


Cat: MO-AB-24046H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24046C
SpecificityThis antibody binds to Rat ALS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains an ATS1/RCC1-like domain, a RhoGEF domain, and a vacuolar protein sorting 9 (VPS9) domain, all of which are guanine-nucleotide exchange factors that activate members of the Ras superfamily of GTPases. The protein functions as a guanine nucleotide exchange factor for the small GTPase RAB5. The protein localizes with RAB5 on early endosomal compartments, and functions as a modulator for endosomal dynamics. Mutations in this gene result in several forms of juvenile lateral sclerosis and infantile-onset ascending spastic paralysis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against ALS2. It can be used for ALS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5-aminolevulinate synthase; EC 2.3.1.37; Alas2
UniProt IDQ9ESE3
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MVAAAMLLRSCPVLSKGPTGLLGKVAKTYQFLFGIGRCPILATQGPTCSQIHLKATKAGADSPSWTKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLLSFMESTTRSQSVPRFQDPEQTGGAPPLLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry