Mouse Anti-Rat Aqp4 Antibody (MO-AB-24132H)
Cat: MO-AB-24132H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24132C |
Specificity | This antibody binds to Rat Aqp4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Endosome; Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. |
Product Overview | This product is a mouse antibody against Aqp4. It can be used for Aqp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aquaporin 4.M23; Aqp4 |
UniProt ID | Q8CIY8 |
Protein Refseq | The length of the protein is 47 amino acids long. The sequence is show below: MVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLPVA. |
See other products for " AQP4 "
MO-AB-51131W | Mouse Anti-Marmoset AQP4 Antibody (MO-AB-51131W) |
CBMOAB-36099FYA | Mouse Anti-Rhesus AQP4 Antibody (CBMOAB-36099FYA) |
MO-AB-00162Y | Mouse Anti-Chicken AQP4 Antibody (MO-AB-00162Y) |
CBMOAB-00594HCB | Mouse Anti-C. elegans AQP4 Antibody (CBMOAB-00594HCB) |
CBMOAB-66241FYA | Mouse Anti-Zebrafish aqp4 Antibody (CBMOAB-66241FYA) |
MO-AB-07527R | Mouse Anti-Cattle AQP4 Antibody (MO-AB-07527R) |
MO-AB-01514H | Mouse Anti-Frog aqp4 Antibody (MO-AB-01514H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry