Mouse Anti-Rat Aqp4 Antibody (MO-AB-24132H)


Cat: MO-AB-24132H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24132C
SpecificityThis antibody binds to Rat Aqp4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endosome; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
Product OverviewThis product is a mouse antibody against Aqp4. It can be used for Aqp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAquaporin 4.M23; Aqp4
UniProt IDQ8CIY8
Protein RefseqThe length of the protein is 47 amino acids long.
The sequence is show below: MVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLPVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry