Mouse Anti-Rat Cbr4 Antibody (MO-AB-24531H)


Cat: MO-AB-24531H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24531C
SpecificityThis antibody binds to Rat Cbr4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCBR4 (Carbonyl Reductase 4) is a protein coding gene. Diseases associated with CBR4 include Horner's Syndrome. Among its related pathways are Metabolism and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and NADPH binding. An important paralog of this gene is HSD17B8.
Product OverviewThis product is a mouse antibody against Cbr4. It can be used for Cbr4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonyl reductase family member 4; 3-oxoacyl-[acyl-carrier-protein] reductase; Quinone reductase CBR4; Cbr4
UniProt IDQ7TS56
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MDKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDVHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQGGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEHFKKNIPLGRFGEALEVAHAVVFLLESPYITGHVLIVDGGLQLTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry