Mouse Anti-Rat Cd28 Antibody (MO-AB-24624H)


Cat: MO-AB-24624H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24624C
SpecificityThis antibody binds to Rat Cd28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD28 (CD28 Molecule) is a protein coding gene. Diseases associated with CD28 include Mycosis Fungoides and Sezary's Disease. Among its related pathways are Th2 Differentiation Pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and SH3/SH2 adaptor activity. An important paralog of this gene is CTLA4.
Product OverviewThis product is a mouse antibody against Cd28. It can be used for Cd28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell-specific surface glycoprotein CD28; CD antigen CD28; Cd28
UniProt IDP31042
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MTLRLLFLALSFFSVQVTENKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWPLVVVAGVLLCYGLLVTVTLCIIWTNSRRNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP.
See other products for " CD28 "
CBMOAB-60868FYCMouse Anti-Rhesus CD28 Antibody (CBMOAB-60868FYC)
MO-AB-29459WMouse Anti-Dog CD28 Antibody (MO-AB-29459W)
MO-AB-34516WMouse Anti-Ferret CD28 Antibody (MO-AB-34516W)
MO-AB-14494YMouse Anti-Sheep CD28 Antibody (MO-AB-14494Y)
MO-AB-02200HMouse Anti-Frog cd28 Antibody (MO-AB-02200H)
MO-AB-52552WMouse Anti-Marmoset CD28 Antibody (MO-AB-52552W)
MO-AB-08577WMouse Anti-Cat CD28 Antibody (MO-AB-08577W)
MOFY-0522-FY15Mouse Anti-CD28 Antibody (MOFY-0522-FY15)
MO-AB-09807RMouse Anti-Cattle CD28 Antibody (MO-AB-09807R)
MO-AB-07523YMouse Anti-Rabbit CD28 Antibody (MO-AB-07523Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry