Mouse Anti-Rat Cd84 Antibody (MO-AB-24657H)


Cat: MO-AB-24657H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24657C
SpecificityThis antibody binds to Rat Cd84.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD84 (CD84 Molecule) is a protein coding gene. Diseases associated with CD84 include Leukemia, Chronic Lymphocytic. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Cell surface interactions at the vascular wall. Gene Ontology (GO) annotations related to this gene include receptor activity. An important paralog of this gene is LY9.
Product OverviewThis product is a mouse antibody against Cd84. It can be used for Cd84 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Cd84; Cd84
UniProt IDF1M0B5
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: FCLGIYSRLAKPKITKSSITSLNNTCNITLTCSVEEEEKNVVYSWSPSGEESNVLQIFHSPMDQKLTYTCTASNPVSNNSDSVTVQQPCTDSPSFHPYHGVLPGGLAALSLLMLIPVVALLFHLYKRRRGRIVLEADDVSKKIIYSAVSRNAHLTESRIYDEIPQSTMLSRTEEPVTTIYSSVQLYEKTGKTNMKDERPPKTLCNEIVV.
See other products for " CD84 "
CBMOAB-38742FYAMouse Anti-Rhesus CD84 Antibody (CBMOAB-38742FYA)
MO-AB-24493RMouse Anti-Pig CD84 Antibody (MO-AB-24493R)
For Research Use Only | Not For Clinical Use.
Online Inquiry