Mouse Anti-Rat Cd9 Antibody (MO-AB-24662H)


Cat: MO-AB-24662H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24662C
SpecificityThis antibody binds to Rat Cd9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD9 (CD9 Molecule) is a protein coding gene. Diseases associated with CD9 include Cytomegalovirus Retinitis and Diphtheria. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Uptake and actions of bacterial toxins. Gene Ontology (GO) annotations related to this gene include integrin binding. An important paralog of this gene is TSPAN2.
Product OverviewThis product is a mouse antibody against Cd9. It can be used for Cd9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD9 antigen; CD antigen CD9; Cd9
UniProt IDP40241
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV.
See other products for " CD9 "
MO-AB-34527WMouse Anti-Ferret CD9 Antibody (MO-AB-34527W)
MO-AB-08908WMouse Anti-Cat CD9 Antibody (MO-AB-08908W)
MO-AB-02217HMouse Anti-Frog cd9 Antibody (MO-AB-02217H)
MO-AB-21982WMouse Anti-Chimpanzee CD9 Antibody (MO-AB-21982W)
MO-AB-06354YMouse Anti-O. anatinus CD9 Antibody (MO-AB-06354Y)
MO-AB-36876WMouse Anti-Goat CD9 Antibody (MO-AB-36876W)
CBMOAB-00087FYAMouse Anti-Bison CD9 Antibody (CBMOAB-00087FYA)
MO-AB-29493WMouse Anti-Dog CD9 Antibody (MO-AB-29493W)
MO-AB-01080YMouse Anti-Chicken CD9 Antibody (MO-AB-01080Y)
CBMOAB-38748FYAMouse Anti-Rhesus CD9 Antibody (CBMOAB-38748FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry