Mouse Anti-Rat Chchd4 Antibody (MO-AB-24758H)


Cat: MO-AB-24758H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24758C
SpecificityThis antibody binds to Rat Chchd4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.
Product OverviewThis product is a mouse antibody against Chchd4. It can be used for Chchd4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial intermembrane space import and assembly protein 40; Coiled-coil-helix-coiled-coil-helix domain-containing protein 4; Chchd4; Mia40
UniProt IDQ5BJN5
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEEEEEEAKPVEPVEETADTKASAAKEQGASS.
See other products for " CHCHD4 "
CBMOAB-39134FYAMouse Anti-Rhesus CHCHD4 Antibody (CBMOAB-39134FYA)
MO-AB-52905WMouse Anti-Marmoset CHCHD4 Antibody (MO-AB-52905W)
MO-AB-22009WMouse Anti-Chimpanzee CHCHD4 Antibody (MO-AB-22009W)
CBMOAB-70301FYAMouse Anti-Zebrafish chchd4 Antibody (CBMOAB-70301FYA)
MO-AB-10141RMouse Anti-Cattle CHCHD4 Antibody (MO-AB-10141R)
For Research Use Only | Not For Clinical Use.
Online Inquiry