Mouse Anti-Rat Cmc2 Antibody (MO-AB-24905H)
Cat: MO-AB-24905H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24905C |
Specificity | This antibody binds to Rat Cmc2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CMC2 (C-X9-C Motif Containing 2) is a protein coding gene. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. |
Product Overview | This product is a mouse antibody against Cmc2. It can be used for Cmc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Cmc2; RCG51296; Cmc2; LOC100363376 |
UniProt ID | D4A471 |
Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGHCNDLDREMRKCLKNEYMEKRNRSREHGAAMRSRLSDPPEETGR. |
See other products for " cmc2 "
CBMOAB-70859FYA | Mouse Anti-Zebrafish cmc2 Antibody (CBMOAB-70859FYA) |
MO-AB-02493H | Mouse Anti-Frog cmc2 Antibody (MO-AB-02493H) |
MO-AB-53230W | Mouse Anti-Marmoset CMC2 Antibody (MO-AB-53230W) |
CBMOAB-39461FYA | Mouse Anti-Rhesus CMC2 Antibody (CBMOAB-39461FYA) |
MO-AB-10381R | Mouse Anti-Cattle CMC2 Antibody (MO-AB-10381R) |
CBMOAB-00757CR | Mouse Anti-Yeast CMC2 Antibody (CBMOAB-00757CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry