Mouse Anti-Rat Coq7 Antibody (MO-AB-24991H)


Cat: MO-AB-24991H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24991C
SpecificityThis antibody binds to Rat Coq7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOQ7 (Coenzyme Q7, Hydroxylase) is a protein coding gene. Diseases associated with COQ7 include Coenzyme Q10 Deficiency, Primary, 8. Among its related pathways are Ubiquinol biosynthesis and Metabolism.
Product OverviewThis product is a mouse antibody against Coq7. It can be used for Coq7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquinone biosynthesis protein COQ7 homolog; Coenzyme Q biosynthesis protein 7 homolog; Timing protein clk-1 homolog; Coq7
UniProt IDQ63619
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMVAFRVRPTVLMPLWNVAGFALGAGTALLGKEGGMACTVAVEESIAHHYNNQIRMLMEEDAEKYEELLQVIKQFRDEELEHHDTGLEHDAELAPAYTLLKRLIQAGCSAAIYLSERF.
See other products for " COQ7 "
CBMOAB-39741FYAMouse Anti-Rhesus COQ7 Antibody (CBMOAB-39741FYA)
MO-AB-53417WMouse Anti-Marmoset COQ7 Antibody (MO-AB-53417W)
MO-AB-23297WMouse Anti-Chimpanzee COQ7 Antibody (MO-AB-23297W)
MO-AB-10589RMouse Anti-Cattle COQ7 Antibody (MO-AB-10589R)
CBMOAB-13769FYAMouse Anti-D. melanogaster Coq7 Antibody (CBMOAB-13769FYA)
MO-AB-11032YMouse Anti-O. mykiss COQ7 Antibody (MO-AB-11032Y)
MO-AB-02578HMouse Anti-Frog coq7 Antibody (MO-AB-02578H)
CBMOAB-71344FYAMouse Anti-Zebrafish coq7 Antibody (CBMOAB-71344FYA)
MO-AB-69502WMouse Anti-Silkworm coq7 Antibody (MO-AB-69502W)
MO-AB-05175YMouse Anti-A. aegpti Coq7 Antibody (MO-AB-05175Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry