Mouse Anti-Rat Ctf1 Antibody (MO-AB-25181H)


Cat: MO-AB-25181H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO25181C
SpecificityThis antibody binds to Rat Ctf1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTF1 (Cardiotrophin 1) is a protein coding gene. Diseases associated with CTF1 include Neonatal Stroke and Hypertensive Heart Disease. Among its related pathways are NFAT and Cardiac Hypertrophy and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include cytokine activity and leukemia inhibitory factor receptor binding.
Product OverviewThis product is a mouse antibody against Ctf1. It can be used for Ctf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCardiotrophin-1; CT-1; Ctf1
UniProt IDQ63086
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA.
See other products for " CTF1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry