Mouse Anti-Rat Cyp2r1 Antibody (MO-AB-25248H)


Cat: MO-AB-25248H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO25248C
SpecificityThis antibody binds to Rat Cyp2r1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2R1 (Cytochrome P450 Family 2 Subfamily R Member 1) is a protein coding gene. Diseases associated with CYP2R1 include Vitamin D Hydroxylation-Deficient Rickets, Type 1B and Hypocalcemic Vitamin D-Dependent Rickets. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP2J2.
Product OverviewThis product is a mouse antibody against Cyp2r1. It can be used for Cyp2r1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450, family 2, subfamily r, polypeptide 1, isoform CRA_b; Protein Cyp2r1; Cyp2r1
UniProt IDF7FAJ1
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MKMTKMGVGELIIAGTETTTNVLRWAVLFMALYPNIQGQVHKEIDLIMGHDRRPSWEDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFLDSSGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHELVPNLKPRLGMTLQPQAYLICAERR.
For Research Use Only | Not For Clinical Use.
Online Inquiry